Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for YeshuaLives 121. YeshuaLives Lv 1 3 pts. 8,550
  2. Avatar for Jim Fraser 122. Jim Fraser Lv 1 3 pts. 8,499
  3. Avatar for Inkedhands 123. Inkedhands Lv 1 2 pts. 8,478
  4. Avatar for rtkitters 124. rtkitters Lv 1 2 pts. 8,468
  5. Avatar for Arne Heessels 125. Arne Heessels Lv 1 2 pts. 8,466
  6. Avatar for Franco Padelletti 126. Franco Padelletti Lv 1 2 pts. 8,458
  7. Avatar for dbuske 127. dbuske Lv 1 2 pts. 8,442
  8. Avatar for fryguy 128. fryguy Lv 1 2 pts. 8,420
  9. Avatar for nagistick 129. nagistick Lv 1 2 pts. 8,410
  10. Avatar for fishercat 130. fishercat Lv 1 2 pts. 8,401

Comments