Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups


  1. Avatar for Go Science 100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899

  1. Avatar for YeshuaLives 121. YeshuaLives Lv 1 3 pts. 8,550
  2. Avatar for Jim Fraser 122. Jim Fraser Lv 1 3 pts. 8,499
  3. Avatar for Inkedhands 123. Inkedhands Lv 1 2 pts. 8,478
  4. Avatar for rtkitters 124. rtkitters Lv 1 2 pts. 8,468
  5. Avatar for Arne Heessels 125. Arne Heessels Lv 1 2 pts. 8,466
  6. Avatar for Franco Padelletti 126. Franco Padelletti Lv 1 2 pts. 8,458
  7. Avatar for dbuske 127. dbuske Lv 1 2 pts. 8,442
  8. Avatar for fryguy 128. fryguy Lv 1 2 pts. 8,420
  9. Avatar for nagistick 129. nagistick Lv 1 2 pts. 8,410
  10. Avatar for fishercat 130. fishercat Lv 1 2 pts. 8,401

Comments