Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for severin333 161. severin333 Lv 1 1 pt. 7,722
  2. Avatar for Hexed404 162. Hexed404 Lv 1 1 pt. 7,622
  3. Avatar for Bo Peponis 163. Bo Peponis Lv 1 1 pt. 7,573
  4. Avatar for khendarg 164. khendarg Lv 1 1 pt. 7,551
  5. Avatar for isantheautumn 165. isantheautumn Lv 1 1 pt. 7,515
  6. Avatar for jovanyfranco 166. jovanyfranco Lv 1 1 pt. 7,484
  7. Avatar for mimo31 167. mimo31 Lv 1 1 pt. 7,477
  8. Avatar for pandabearsecond 168. pandabearsecond Lv 1 1 pt. 7,476
  9. Avatar for Gracier 169. Gracier Lv 1 1 pt. 7,453
  10. Avatar for Mydogisa Toelicker 170. Mydogisa Toelicker Lv 1 1 pt. 7,435

Comments