Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for severin333 161. severin333 Lv 1 1 pt. 7,722
  2. Avatar for Hexed404 162. Hexed404 Lv 1 1 pt. 7,622
  3. Avatar for Bo Peponis 163. Bo Peponis Lv 1 1 pt. 7,573
  4. Avatar for khendarg 164. khendarg Lv 1 1 pt. 7,551
  5. Avatar for isantheautumn 165. isantheautumn Lv 1 1 pt. 7,515
  6. Avatar for jovanyfranco 166. jovanyfranco Lv 1 1 pt. 7,484
  7. Avatar for mimo31 167. mimo31 Lv 1 1 pt. 7,477
  8. Avatar for pandabearsecond 168. pandabearsecond Lv 1 1 pt. 7,476
  9. Avatar for Gracier 169. Gracier Lv 1 1 pt. 7,453
  10. Avatar for Mydogisa Toelicker 170. Mydogisa Toelicker Lv 1 1 pt. 7,435

Comments