Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for mirjamvandelft 171. mirjamvandelft Lv 1 1 pt. 7,426
  2. Avatar for wackn 172. wackn Lv 1 1 pt. 7,371
  3. Avatar for Tac1 173. Tac1 Lv 1 1 pt. 7,363
  4. Avatar for Mohambone 174. Mohambone Lv 1 1 pt. 7,359
  5. Avatar for kentaroro 175. kentaroro Lv 1 1 pt. 7,358
  6. Avatar for metafolder 176. metafolder Lv 1 1 pt. 7,341
  7. Avatar for TJOK fan 177. TJOK fan Lv 1 1 pt. 7,331
  8. Avatar for PrettyPony2001 178. PrettyPony2001 Lv 1 1 pt. 7,321
  9. Avatar for Pro Lapser 179. Pro Lapser Lv 1 1 pt. 7,315
  10. Avatar for Rumen_hack 180. Rumen_hack Lv 1 1 pt. 7,311

Comments