Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for mirjamvandelft 171. mirjamvandelft Lv 1 1 pt. 7,426
  2. Avatar for wackn 172. wackn Lv 1 1 pt. 7,371
  3. Avatar for Tac1 173. Tac1 Lv 1 1 pt. 7,363
  4. Avatar for Mohambone 174. Mohambone Lv 1 1 pt. 7,359
  5. Avatar for kentaroro 175. kentaroro Lv 1 1 pt. 7,358
  6. Avatar for metafolder 176. metafolder Lv 1 1 pt. 7,341
  7. Avatar for TJOK fan 177. TJOK fan Lv 1 1 pt. 7,331
  8. Avatar for PrettyPony2001 178. PrettyPony2001 Lv 1 1 pt. 7,321
  9. Avatar for Pro Lapser 179. Pro Lapser Lv 1 1 pt. 7,315
  10. Avatar for Rumen_hack 180. Rumen_hack Lv 1 1 pt. 7,311

Comments