Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for guineapig 61. guineapig Lv 1 21 pts. 9,030
  2. Avatar for bendbob 62. bendbob Lv 1 21 pts. 9,023
  3. Avatar for manu8170 63. manu8170 Lv 1 20 pts. 9,014
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 20 pts. 9,011
  5. Avatar for gurch 65. gurch Lv 1 19 pts. 9,011
  6. Avatar for tarimo 66. tarimo Lv 1 18 pts. 9,007
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 18 pts. 8,997
  8. Avatar for smholst 68. smholst Lv 1 17 pts. 8,994
  9. Avatar for ManVsYard 69. ManVsYard Lv 1 17 pts. 8,970
  10. Avatar for diamonddays 70. diamonddays Lv 1 16 pts. 8,969

Comments