Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for guineapig 61. guineapig Lv 1 21 pts. 9,030
  2. Avatar for bendbob 62. bendbob Lv 1 21 pts. 9,023
  3. Avatar for manu8170 63. manu8170 Lv 1 20 pts. 9,014
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 20 pts. 9,011
  5. Avatar for gurch 65. gurch Lv 1 19 pts. 9,011
  6. Avatar for tarimo 66. tarimo Lv 1 18 pts. 9,007
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 18 pts. 8,997
  8. Avatar for smholst 68. smholst Lv 1 17 pts. 8,994
  9. Avatar for ManVsYard 69. ManVsYard Lv 1 17 pts. 8,970
  10. Avatar for diamonddays 70. diamonddays Lv 1 16 pts. 8,969

Comments