Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,023

  1. Avatar for KarenCH 11. KarenCH Lv 1 80 pts. 9,301
  2. Avatar for nemo7731 12. nemo7731 Lv 1 78 pts. 9,298
  3. Avatar for Deleted player 13. Deleted player pts. 9,294
  4. Avatar for phi16 14. phi16 Lv 1 75 pts. 9,293
  5. Avatar for gmn 15. gmn Lv 1 73 pts. 9,291
  6. Avatar for actiasluna 16. actiasluna Lv 1 71 pts. 9,289
  7. Avatar for Mark- 17. Mark- Lv 1 69 pts. 9,278
  8. Avatar for MurloW 18. MurloW Lv 1 68 pts. 9,278
  9. Avatar for Madde 19. Madde Lv 1 66 pts. 9,270
  10. Avatar for LociOiling 20. LociOiling Lv 1 65 pts. 9,249

Comments