Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for guineapig 61. guineapig Lv 1 21 pts. 9,030
  2. Avatar for bendbob 62. bendbob Lv 1 21 pts. 9,023
  3. Avatar for manu8170 63. manu8170 Lv 1 20 pts. 9,014
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 20 pts. 9,011
  5. Avatar for gurch 65. gurch Lv 1 19 pts. 9,011
  6. Avatar for tarimo 66. tarimo Lv 1 18 pts. 9,007
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 18 pts. 8,997
  8. Avatar for smholst 68. smholst Lv 1 17 pts. 8,994
  9. Avatar for ManVsYard 69. ManVsYard Lv 1 17 pts. 8,970
  10. Avatar for diamonddays 70. diamonddays Lv 1 16 pts. 8,969

Comments