Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for r.gupta 201. r.gupta Lv 1 1 pt. 5,991
  2. Avatar for CubicB 202. CubicB Lv 1 1 pt. 5,990
  3. Avatar for zkm 203. zkm Lv 1 1 pt. 5,922
  4. Avatar for MaartenDesnouck 204. MaartenDesnouck Lv 1 1 pt. 5,908
  5. Avatar for cherrymonkey 205. cherrymonkey Lv 1 1 pt. 5,861
  6. Avatar for possumfold 206. possumfold Lv 1 1 pt. 5,853
  7. Avatar for lexyj 207. lexyj Lv 1 1 pt. 5,830
  8. Avatar for brgreening 208. brgreening Lv 1 1 pt. 5,568
  9. Avatar for ktrain12 209. ktrain12 Lv 1 1 pt. 5,486
  10. Avatar for Sydefecks 210. Sydefecks Lv 1 1 pt. 5,306

Comments