Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819
  1. Avatar for isaksson 41. isaksson Lv 1 40 pts. 9,879
  2. Avatar for crpainter 42. crpainter Lv 1 39 pts. 9,860
  3. Avatar for manu8170 43. manu8170 Lv 1 38 pts. 9,849
  4. Avatar for diamonddays 44. diamonddays Lv 1 37 pts. 9,846
  5. Avatar for Giant Berk 45. Giant Berk Lv 1 36 pts. 9,845
  6. Avatar for jobo0502 46. jobo0502 Lv 1 35 pts. 9,835
  7. Avatar for andrewxc 47. andrewxc Lv 1 34 pts. 9,829
  8. Avatar for froggs554 48. froggs554 Lv 1 33 pts. 9,827
  9. Avatar for joremen 49. joremen Lv 1 32 pts. 9,824
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 31 pts. 9,824

Comments