Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086
  1. Avatar for isaksson 41. isaksson Lv 1 40 pts. 9,879
  2. Avatar for crpainter 42. crpainter Lv 1 39 pts. 9,860
  3. Avatar for manu8170 43. manu8170 Lv 1 38 pts. 9,849
  4. Avatar for diamonddays 44. diamonddays Lv 1 37 pts. 9,846
  5. Avatar for Giant Berk 45. Giant Berk Lv 1 36 pts. 9,845
  6. Avatar for jobo0502 46. jobo0502 Lv 1 35 pts. 9,835
  7. Avatar for andrewxc 47. andrewxc Lv 1 34 pts. 9,829
  8. Avatar for froggs554 48. froggs554 Lv 1 33 pts. 9,827
  9. Avatar for joremen 49. joremen Lv 1 32 pts. 9,824
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 31 pts. 9,824

Comments