Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086
  1. Avatar for sheerbliss 61. sheerbliss Lv 1 23 pts. 9,773
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 23 pts. 9,768
  3. Avatar for jamiexq 63. jamiexq Lv 1 22 pts. 9,765
  4. Avatar for gurch 64. gurch Lv 1 21 pts. 9,764
  5. Avatar for JMStiffler 65. JMStiffler Lv 1 21 pts. 9,748
  6. Avatar for hansvandenhof 66. hansvandenhof Lv 1 20 pts. 9,747
  7. Avatar for t012 67. t012 Lv 1 20 pts. 9,741
  8. Avatar for tarimo 68. tarimo Lv 1 19 pts. 9,735
  9. Avatar for Bushman 69. Bushman Lv 1 18 pts. 9,730
  10. Avatar for Deleted player 70. Deleted player pts. 9,729

Comments