Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819
  1. Avatar for sheerbliss 61. sheerbliss Lv 1 23 pts. 9,773
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 23 pts. 9,768
  3. Avatar for jamiexq 63. jamiexq Lv 1 22 pts. 9,765
  4. Avatar for gurch 64. gurch Lv 1 21 pts. 9,764
  5. Avatar for JMStiffler 65. JMStiffler Lv 1 21 pts. 9,748
  6. Avatar for hansvandenhof 66. hansvandenhof Lv 1 20 pts. 9,747
  7. Avatar for t012 67. t012 Lv 1 20 pts. 9,741
  8. Avatar for tarimo 68. tarimo Lv 1 19 pts. 9,735
  9. Avatar for Bushman 69. Bushman Lv 1 18 pts. 9,730
  10. Avatar for Deleted player 70. Deleted player pts. 9,729

Comments