Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819

  1. Avatar for GreekCivilization 191. GreekCivilization Lv 1 1 pt. 9,041
  2. Avatar for citric acid 192. citric acid Lv 1 1 pt. 9,040
  3. Avatar for bob1928 193. bob1928 Lv 1 1 pt. 9,025
  4. Avatar for aspadistra 194. aspadistra Lv 1 1 pt. 9,020
  5. Avatar for briemoney 195. briemoney Lv 1 1 pt. 9,013
  6. Avatar for tnghi 196. tnghi Lv 1 1 pt. 9,012
  7. Avatar for Close At Hand 197. Close At Hand Lv 1 1 pt. 9,002
  8. Avatar for Gracier 198. Gracier Lv 1 1 pt. 8,994
  9. Avatar for Andi1960 199. Andi1960 Lv 1 1 pt. 8,976
  10. Avatar for will2216 200. will2216 Lv 1 1 pt. 8,954

Comments