Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819
  1. Avatar for Mr_forskare04 221. Mr_forskare04 Lv 1 1 pt. 8,310
  2. Avatar for thegr8guitar 222. thegr8guitar Lv 1 1 pt. 8,255
  3. Avatar for Susume 223. Susume Lv 1 1 pt. 8,244
  4. Avatar for aiden123 224. aiden123 Lv 1 1 pt. 8,238
  5. Avatar for Jakem8 225. Jakem8 Lv 1 1 pt. 8,224
  6. Avatar for Marvelz 226. Marvelz Lv 1 1 pt. 8,157
  7. Avatar for FreeFolder 227. FreeFolder Lv 1 1 pt. 8,152
  8. Avatar for KOLTik 228. KOLTik Lv 1 1 pt. 8,150
  9. Avatar for bkoep 229. bkoep Lv 1 1 pt. 8,148
  10. Avatar for Shelby0810 230. Shelby0810 Lv 1 1 pt. 8,148

Comments