Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for uihcv 111. uihcv Lv 1 4 pts. 8,625
  2. Avatar for pfirth 112. pfirth Lv 1 4 pts. 8,622
  3. Avatar for darioarena 113. darioarena Lv 1 4 pts. 8,597
  4. Avatar for Jim Fraser 114. Jim Fraser Lv 1 4 pts. 8,580
  5. Avatar for TheStaticSloth 115. TheStaticSloth Lv 1 3 pts. 8,550
  6. Avatar for Ellis Shih 116. Ellis Shih Lv 1 3 pts. 8,472
  7. Avatar for harvardman 117. harvardman Lv 1 3 pts. 8,406
  8. Avatar for aiden123 118. aiden123 Lv 1 3 pts. 8,366
  9. Avatar for Punktchen 119. Punktchen Lv 1 3 pts. 8,325
  10. Avatar for momadoc 120. momadoc Lv 1 3 pts. 8,317

Comments