Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for martinf 121. martinf Lv 1 3 pts. 8,304
  2. Avatar for Tlaloc 122. Tlaloc Lv 1 3 pts. 8,285
  3. Avatar for bwkittitas 123. bwkittitas Lv 1 3 pts. 8,252
  4. Avatar for parsnip 124. parsnip Lv 1 2 pts. 8,244
  5. Avatar for dahast.de 125. dahast.de Lv 1 2 pts. 8,175
  6. Avatar for xplocast1 126. xplocast1 Lv 1 2 pts. 8,155
  7. Avatar for itboswelll 127. itboswelll Lv 1 2 pts. 8,148
  8. Avatar for bob1928 128. bob1928 Lv 1 2 pts. 8,130
  9. Avatar for kitek314_pl 129. kitek314_pl Lv 1 2 pts. 8,114
  10. Avatar for dbuske 130. dbuske Lv 1 2 pts. 8,088

Comments