Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882

  1. Avatar for Wheeler22 151. Wheeler22 Lv 1 1 pt. 7,579
  2. Avatar for Hollinas 152. Hollinas Lv 1 1 pt. 7,564
  3. Avatar for Spero32 153. Spero32 Lv 1 1 pt. 7,483
  4. Avatar for ragadhousni 154. ragadhousni Lv 1 1 pt. 7,366
  5. Avatar for DrTree 155. DrTree Lv 1 1 pt. 7,353
  6. Avatar for atomusuku 157. atomusuku Lv 1 1 pt. 7,284
  7. Avatar for CureForDiabetes 158. CureForDiabetes Lv 1 1 pt. 7,257
  8. Avatar for alejandroMadrid 159. alejandroMadrid Lv 1 1 pt. 7,255
  9. Avatar for ivalnic 160. ivalnic Lv 1 1 pt. 7,254

Comments