Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for WarpSpeed 51. WarpSpeed Lv 1 29 pts. 9,215
  2. Avatar for georg137 52. georg137 Lv 1 28 pts. 9,209
  3. Avatar for dcrwheeler 53. dcrwheeler Lv 1 28 pts. 9,203
  4. Avatar for WBarme1234 54. WBarme1234 Lv 1 27 pts. 9,184
  5. Avatar for jermainiac 55. jermainiac Lv 1 26 pts. 9,159
  6. Avatar for Graham MF 56. Graham MF Lv 1 25 pts. 9,151
  7. Avatar for joremen 57. joremen Lv 1 25 pts. 9,149
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 24 pts. 9,136
  9. Avatar for smholst 59. smholst Lv 1 23 pts. 9,125
  10. Avatar for Museka 60. Museka Lv 1 23 pts. 9,106

Comments