Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for Bruno Kestemont 31. Bruno Kestemont Lv 1 50 pts. 9,294
  2. Avatar for steveB 32. steveB Lv 1 48 pts. 9,292
  3. Avatar for pmdpmd 33. pmdpmd Lv 1 47 pts. 9,289
  4. Avatar for stomjoh 34. stomjoh Lv 1 46 pts. 9,275
  5. Avatar for gmn 35. gmn Lv 1 45 pts. 9,274
  6. Avatar for jobo0502 36. jobo0502 Lv 1 44 pts. 9,270
  7. Avatar for lynnai 37. lynnai Lv 1 42 pts. 9,269
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 41 pts. 9,266
  9. Avatar for Bletchley Park 39. Bletchley Park Lv 1 40 pts. 9,260
  10. Avatar for gloverd 40. gloverd Lv 1 39 pts. 9,254

Comments