Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for SouperGenious 151. SouperGenious Lv 1 1 pt. 7,786
  2. Avatar for lockert 152. lockert Lv 1 1 pt. 7,770
  3. Avatar for parsnip 153. parsnip Lv 1 1 pt. 7,766
  4. Avatar for dahast.de 154. dahast.de Lv 1 1 pt. 7,754
  5. Avatar for cynwulf28 155. cynwulf28 Lv 1 1 pt. 7,752
  6. Avatar for DrTree 156. DrTree Lv 1 1 pt. 7,730
  7. Avatar for mirjamvandelft 157. mirjamvandelft Lv 1 1 pt. 7,712
  8. Avatar for rinze 158. rinze Lv 1 1 pt. 7,692
  9. Avatar for 01010011111 159. 01010011111 Lv 1 1 pt. 7,676
  10. Avatar for tscarberry1 160. tscarberry1 Lv 1 1 pt. 7,658

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.