Placeholder image of a protein
Icon representing a puzzle

1213: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 30, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,475
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 10,465
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 68 pts. 10,450
  4. Avatar for Contenders 4. Contenders 55 pts. 10,440
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 44 pts. 10,416
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,384
  7. Avatar for HMT heritage 7. HMT heritage 27 pts. 10,383
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,300
  9. Avatar for Deleted group 9. Deleted group pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 12 pts. 10,127

  1. Avatar for PrettyPony2001 121. PrettyPony2001 Lv 1 3 pts. 9,256
  2. Avatar for Mohambone 122. Mohambone Lv 1 2 pts. 9,233
  3. Avatar for SouperGenious 123. SouperGenious Lv 1 2 pts. 9,230
  4. Avatar for Punktchen 124. Punktchen Lv 1 2 pts. 9,226
  5. Avatar for tela 125. tela Lv 1 2 pts. 9,225
  6. Avatar for sumanthratna 126. sumanthratna Lv 1 2 pts. 9,224
  7. Avatar for pandapharmd 127. pandapharmd Lv 1 2 pts. 9,220
  8. Avatar for momadoc 128. momadoc Lv 1 2 pts. 9,214
  9. Avatar for Mydogisa Toelicker 129. Mydogisa Toelicker Lv 1 2 pts. 9,211
  10. Avatar for DrTree 130. DrTree Lv 1 2 pts. 9,207

Comments


LociOiling Lv 1

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.

Susume Lv 1

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29 Lv 1

Running 3 disulfide bonds, main, Win 10, 64,(drw)

*** STARTING THREAD ActionGlobalMinimize
delta_score: 50.1436
Playing sound: 5
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
*** STARTING THREAD ActionGlobalMinimize
delta_score: -356.433
Playing sound: 2
**
* ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize

UNHANDLED EXCEPTION
1: library_main +46812112 bytes (no line)
2: library_main +40217 bytes (no line)
3: library_main +44517492 bytes (no line)
4: library_main +25168 bytes (no line)
5: library_main +5509 bytes (no line)
6: library_main +42535263 bytes (no line)
7: library_main +41750807 bytes (no line)
8: library_main +41747510 bytes (no line)
9: library_main +41739662 bytes (no line)
10: library_main +37145835 bytes (no line)
11: library_main +37149947 bytes (no line)
12: library_main +33197162 bytes (no line)
13: library_main +33136830 bytes (no line)
14: library_main +5334996 bytes (no line)
15: library_main +5332860 bytes (no line)
16: library_main +4356837 bytes (no line)
17: library_main +4357291 bytes (no line)
18: BaseThreadInitThunk +36 bytes (no line)
19: RtlUnicodeStringToInteger +595 bytes (no line)
20: RtlUnicodeStringToInteger +542 bytes (no line)