Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 8,390
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 7,607
  3. Avatar for Deleted group 13. Deleted group pts. 5,349
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 59 pts. 9,030
  2. Avatar for Blipperman 12. Blipperman Lv 1 56 pts. 9,026
  3. Avatar for Aubade01 13. Aubade01 Lv 1 53 pts. 9,014
  4. Avatar for gdnskye 14. gdnskye Lv 1 50 pts. 9,013
  5. Avatar for Glen B 15. Glen B Lv 1 47 pts. 9,012
  6. Avatar for Qfast 16. Qfast Lv 1 44 pts. 9,008
  7. Avatar for gloverd 17. gloverd Lv 1 42 pts. 9,008
  8. Avatar for TomTaylor 18. TomTaylor Lv 1 39 pts. 9,001
  9. Avatar for gurch 19. gurch Lv 1 37 pts. 8,975
  10. Avatar for reefyrob 20. reefyrob Lv 1 35 pts. 8,972

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE