Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,271
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 9,123
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,082
  4. Avatar for Go Science 4. Go Science 24 pts. 9,075
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 9,062
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,026
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 8,969
  8. Avatar for Bad Monkey 8. Bad Monkey 2 pts. 8,947
  9. Avatar for Deleted group 9. Deleted group pts. 8,916
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 8,753
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 59 pts. 9,030
  2. Avatar for Blipperman 12. Blipperman Lv 1 56 pts. 9,026
  3. Avatar for Aubade01 13. Aubade01 Lv 1 53 pts. 9,014
  4. Avatar for gdnskye 14. gdnskye Lv 1 50 pts. 9,013
  5. Avatar for Glen B 15. Glen B Lv 1 47 pts. 9,012
  6. Avatar for Qfast 16. Qfast Lv 1 44 pts. 9,008
  7. Avatar for gloverd 17. gloverd Lv 1 42 pts. 9,008
  8. Avatar for TomTaylor 18. TomTaylor Lv 1 39 pts. 9,001
  9. Avatar for gurch 19. gurch Lv 1 37 pts. 8,975
  10. Avatar for reefyrob 20. reefyrob Lv 1 35 pts. 8,972

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE