Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate

Summary


Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Contenders 100 pts. 9,271
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 9,123
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,082
  4. Avatar for Go Science 4. Go Science 24 pts. 9,075
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 9,062
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,026
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 8,969
  8. Avatar for Bad Monkey 8. Bad Monkey 2 pts. 8,947
  9. Avatar for Deleted group 9. Deleted group pts. 8,916
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 8,753

  1. Avatar for Deleted player 41. Deleted player pts. 8,472
  2. Avatar for sean4046 42. sean4046 Lv 1 7 pts. 8,432
  3. Avatar for diamonddays 43. diamonddays Lv 1 7 pts. 8,413
  4. Avatar for SamuelJackson 44. SamuelJackson Lv 1 6 pts. 8,410
  5. Avatar for Mike Cassidy 45. Mike Cassidy Lv 1 6 pts. 8,390
  6. Avatar for JUMELLE54 46. JUMELLE54 Lv 1 5 pts. 8,387
  7. Avatar for joremen 47. joremen Lv 1 5 pts. 8,384
  8. Avatar for Jim Fraser 48. Jim Fraser Lv 1 4 pts. 8,342
  9. Avatar for fishercat 49. fishercat Lv 1 4 pts. 8,328
  10. Avatar for bendbob 50. bendbob Lv 1 4 pts. 8,264

Comments


Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE