Placeholder image of a protein
Icon representing a puzzle

1215: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate

Summary

Created
April 02, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,271
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 9,123
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,082
  4. Avatar for Go Science 4. Go Science 24 pts. 9,075
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 9,062
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 9,026
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 8,969
  8. Avatar for Bad Monkey 8. Bad Monkey 2 pts. 8,947
  9. Avatar for Deleted group 9. Deleted group pts. 8,916
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 8,753
  1. Avatar for bwkittitas 71. bwkittitas Lv 1 1 pt. 7,049
  2. Avatar for Skippysk8s 72. Skippysk8s Lv 1 1 pt. 7,014
  3. Avatar for fulikalter 73. fulikalter Lv 1 1 pt. 6,703
  4. Avatar for lockert 74. lockert Lv 1 1 pt. 6,409
  5. Avatar for Truncheon Luncheon 75. Truncheon Luncheon Lv 1 1 pt. 6,235
  6. Avatar for TJOK fan 76. TJOK fan Lv 1 1 pt. 6,194
  7. Avatar for dahast.de 77. dahast.de Lv 1 1 pt. 6,166
  8. Avatar for Colostomy EXPLOSION. 78. Colostomy EXPLOSION. Lv 1 1 pt. 6,132
  9. Avatar for Anfinsen_slept_here 79. Anfinsen_slept_here Lv 1 1 pt. 5,965
  10. Avatar for ratqueen03 80. ratqueen03 Lv 1 1 pt. 5,923

Comments

Susume Lv 1

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE