Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,853
  2. Avatar for Bad Monkey 12. Bad Monkey 3 pts. 8,778
  3. Avatar for Mojo Risin' 13. Mojo Risin' 2 pts. 8,530
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,436
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,166
  6. Avatar for D001x Med Chem MOOC 16. D001x Med Chem MOOC 1 pt. 8,144
  7. Avatar for Natural Abilities 18. Natural Abilities 1 pt. 7,144
  8. Avatar for Deleted group 19. Deleted group pts. 6,656
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,653

  1. Avatar for Glen B 61. Glen B Lv 1 23 pts. 8,848
  2. Avatar for Satina 62. Satina Lv 1 22 pts. 8,843
  3. Avatar for fiendish_ghoul 63. fiendish_ghoul Lv 1 21 pts. 8,838
  4. Avatar for smilingone 64. smilingone Lv 1 21 pts. 8,837
  5. Avatar for Bushman 65. Bushman Lv 1 20 pts. 8,837
  6. Avatar for Vinara 66. Vinara Lv 1 20 pts. 8,831
  7. Avatar for Mike Lewis 67. Mike Lewis Lv 1 19 pts. 8,821
  8. Avatar for alcor29 68. alcor29 Lv 1 19 pts. 8,820
  9. Avatar for Anfinsen_slept_here 69. Anfinsen_slept_here Lv 1 18 pts. 8,815
  10. Avatar for alwen 70. alwen Lv 1 17 pts. 8,814

Comments