Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987
  1. Avatar for Glen B 61. Glen B Lv 1 23 pts. 8,848
  2. Avatar for Satina 62. Satina Lv 1 22 pts. 8,843
  3. Avatar for fiendish_ghoul 63. fiendish_ghoul Lv 1 21 pts. 8,838
  4. Avatar for smilingone 64. smilingone Lv 1 21 pts. 8,837
  5. Avatar for Bushman 65. Bushman Lv 1 20 pts. 8,837
  6. Avatar for Vinara 66. Vinara Lv 1 20 pts. 8,831
  7. Avatar for Mike Lewis 67. Mike Lewis Lv 1 19 pts. 8,821
  8. Avatar for alcor29 68. alcor29 Lv 1 19 pts. 8,820
  9. Avatar for Anfinsen_slept_here 69. Anfinsen_slept_here Lv 1 18 pts. 8,815
  10. Avatar for alwen 70. alwen Lv 1 17 pts. 8,814

Comments