Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for DrTree 161. DrTree Lv 1 1 pt. 7,772
  2. Avatar for dahast.de 162. dahast.de Lv 1 1 pt. 7,768
  3. Avatar for Cerzax 163. Cerzax Lv 1 1 pt. 7,764
  4. Avatar for jarbolol15 164. jarbolol15 Lv 1 1 pt. 7,760
  5. Avatar for RaeRae61 165. RaeRae61 Lv 1 1 pt. 7,742
  6. Avatar for Tehnologik1 166. Tehnologik1 Lv 1 1 pt. 7,733
  7. Avatar for Sanaht 167. Sanaht Lv 1 1 pt. 7,706
  8. Avatar for Jannu 168. Jannu Lv 1 1 pt. 7,696
  9. Avatar for BMDragon 169. BMDragon Lv 1 1 pt. 7,685
  10. Avatar for tabbycat10uk 170. tabbycat10uk Lv 1 1 pt. 7,681

Comments