Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  1. Avatar for Marvelz 71. Marvelz Lv 1 17 pts. 8,811
  2. Avatar for weitzen 72. weitzen Lv 1 16 pts. 8,803
  3. Avatar for yoyoparis 73. yoyoparis Lv 1 16 pts. 8,786
  4. Avatar for pvc78 74. pvc78 Lv 1 15 pts. 8,782
  5. Avatar for Auntecedent 75. Auntecedent Lv 1 15 pts. 8,781
  6. Avatar for Origami314 76. Origami314 Lv 1 15 pts. 8,779
  7. Avatar for MattTheGeek 77. MattTheGeek Lv 1 14 pts. 8,778
  8. Avatar for isaksson 78. isaksson Lv 1 14 pts. 8,773
  9. Avatar for t012 79. t012 Lv 1 13 pts. 8,772
  10. Avatar for fishercat 80. fishercat Lv 1 13 pts. 8,750

Comments