Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Void Crushers 100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987

  1. Avatar for Marvelz 71. Marvelz Lv 1 17 pts. 8,811
  2. Avatar for weitzen 72. weitzen Lv 1 16 pts. 8,803
  3. Avatar for yoyoparis 73. yoyoparis Lv 1 16 pts. 8,786
  4. Avatar for pvc78 74. pvc78 Lv 1 15 pts. 8,782
  5. Avatar for Auntecedent 75. Auntecedent Lv 1 15 pts. 8,781
  6. Avatar for Origami314 76. Origami314 Lv 1 15 pts. 8,779
  7. Avatar for MattTheGeek 77. MattTheGeek Lv 1 14 pts. 8,778
  8. Avatar for isaksson 78. isaksson Lv 1 14 pts. 8,773
  9. Avatar for t012 79. t012 Lv 1 13 pts. 8,772
  10. Avatar for fishercat 80. fishercat Lv 1 13 pts. 8,750

Comments