Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for hada 81. hada Lv 1 12 pts. 8,747
  2. Avatar for SKSbell 82. SKSbell Lv 1 12 pts. 8,746
  3. Avatar for ratqueen03 83. ratqueen03 Lv 1 12 pts. 8,743
  4. Avatar for YeshuaLives 84. YeshuaLives Lv 1 11 pts. 8,742
  5. Avatar for ecali 85. ecali Lv 1 11 pts. 8,736
  6. Avatar for smholst 86. smholst Lv 1 11 pts. 8,721
  7. Avatar for manu8170 87. manu8170 Lv 1 10 pts. 8,718
  8. Avatar for tallguy-13088 88. tallguy-13088 Lv 1 10 pts. 8,716
  9. Avatar for georg137 89. georg137 Lv 1 10 pts. 8,712
  10. Avatar for NinjaGreg 90. NinjaGreg Lv 1 9 pts. 8,710

Comments