Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Void Crushers 100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987

  1. Avatar for hada 81. hada Lv 1 12 pts. 8,747
  2. Avatar for SKSbell 82. SKSbell Lv 1 12 pts. 8,746
  3. Avatar for ratqueen03 83. ratqueen03 Lv 1 12 pts. 8,743
  4. Avatar for YeshuaLives 84. YeshuaLives Lv 1 11 pts. 8,742
  5. Avatar for ecali 85. ecali Lv 1 11 pts. 8,736
  6. Avatar for smholst 86. smholst Lv 1 11 pts. 8,721
  7. Avatar for manu8170 87. manu8170 Lv 1 10 pts. 8,718
  8. Avatar for tallguy-13088 88. tallguy-13088 Lv 1 10 pts. 8,716
  9. Avatar for georg137 89. georg137 Lv 1 10 pts. 8,712
  10. Avatar for NinjaGreg 90. NinjaGreg Lv 1 9 pts. 8,710

Comments