Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for DodoBird 101. DodoBird Lv 1 6 pts. 9,531
  2. Avatar for froggs554 102. froggs554 Lv 1 5 pts. 9,526
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 5 pts. 9,524
  4. Avatar for ecali 104. ecali Lv 1 5 pts. 9,520
  5. Avatar for arginia 105. arginia Lv 1 5 pts. 9,517
  6. Avatar for mrmookie 106. mrmookie Lv 1 5 pts. 9,508
  7. Avatar for MaartenDesnouck 107. MaartenDesnouck Lv 1 4 pts. 9,507
  8. Avatar for jebbiek 108. jebbiek Lv 1 4 pts. 9,497
  9. Avatar for Mr_Jolty 109. Mr_Jolty Lv 1 4 pts. 9,493
  10. Avatar for pfirth 110. pfirth Lv 1 4 pts. 9,489

Comments