Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for Mike Cassidy 121. Mike Cassidy Lv 1 3 pts. 9,457
  2. Avatar for penteplayer 122. penteplayer Lv 1 3 pts. 9,448
  3. Avatar for Punktchen 123. Punktchen Lv 1 2 pts. 9,448
  4. Avatar for Soggy Doglog 124. Soggy Doglog Lv 1 2 pts. 9,448
  5. Avatar for GreekCivilization 125. GreekCivilization Lv 1 2 pts. 9,447
  6. Avatar for Psych0Active 126. Psych0Active Lv 1 2 pts. 9,446
  7. Avatar for inkycatz 127. inkycatz Lv 1 2 pts. 9,439
  8. Avatar for Marvelz 128. Marvelz Lv 1 2 pts. 9,437
  9. Avatar for mitarcher 129. mitarcher Lv 1 2 pts. 9,431
  10. Avatar for sumanthratna 130. sumanthratna Lv 1 2 pts. 9,423

Comments