Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665

  1. Avatar for Mike Cassidy 121. Mike Cassidy Lv 1 3 pts. 9,457
  2. Avatar for penteplayer 122. penteplayer Lv 1 3 pts. 9,448
  3. Avatar for Punktchen 123. Punktchen Lv 1 2 pts. 9,448
  4. Avatar for Soggy Doglog 124. Soggy Doglog Lv 1 2 pts. 9,448
  5. Avatar for GreekCivilization 125. GreekCivilization Lv 1 2 pts. 9,447
  6. Avatar for Psych0Active 126. Psych0Active Lv 1 2 pts. 9,446
  7. Avatar for inkycatz 127. inkycatz Lv 1 2 pts. 9,439
  8. Avatar for Marvelz 128. Marvelz Lv 1 2 pts. 9,437
  9. Avatar for mitarcher 129. mitarcher Lv 1 2 pts. 9,431
  10. Avatar for sumanthratna 130. sumanthratna Lv 1 2 pts. 9,423

Comments