Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286

  1. Avatar for Jajaboman 161. Jajaboman Lv 1 1 pt. 9,230
  2. Avatar for Dom42 162. Dom42 Lv 1 1 pt. 9,226
  3. Avatar for parsnip 163. parsnip Lv 1 1 pt. 9,224
  4. Avatar for rol 164. rol Lv 1 1 pt. 9,219
  5. Avatar for Tac1 165. Tac1 Lv 1 1 pt. 9,206
  6. Avatar for Arne Heessels 166. Arne Heessels Lv 1 1 pt. 9,202
  7. Avatar for Deleted player 167. Deleted player 1 pt. 9,199
  8. Avatar for proteansoup 168. proteansoup Lv 1 1 pt. 9,193
  9. Avatar for tabbycat10uk 169. tabbycat10uk Lv 1 1 pt. 9,191
  10. Avatar for isantheautumn 170. isantheautumn Lv 1 1 pt. 9,190

Comments