Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665
  1. Avatar for Jajaboman 161. Jajaboman Lv 1 1 pt. 9,230
  2. Avatar for Dom42 162. Dom42 Lv 1 1 pt. 9,226
  3. Avatar for parsnip 163. parsnip Lv 1 1 pt. 9,224
  4. Avatar for rol 164. rol Lv 1 1 pt. 9,219
  5. Avatar for Tac1 165. Tac1 Lv 1 1 pt. 9,206
  6. Avatar for Arne Heessels 166. Arne Heessels Lv 1 1 pt. 9,202
  7. Avatar for Deleted player 167. Deleted player 1 pt. 9,199
  8. Avatar for proteansoup 168. proteansoup Lv 1 1 pt. 9,193
  9. Avatar for tabbycat10uk 169. tabbycat10uk Lv 1 1 pt. 9,191
  10. Avatar for isantheautumn 170. isantheautumn Lv 1 1 pt. 9,190

Comments