Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for dahast.de 191. dahast.de Lv 1 1 pt. 9,076
  2. Avatar for Linapanama 192. Linapanama Lv 1 1 pt. 9,065
  3. Avatar for gab171 193. gab171 Lv 1 1 pt. 9,063
  4. Avatar for jermainiac 194. jermainiac Lv 1 1 pt. 9,056
  5. Avatar for Close At Hand 195. Close At Hand Lv 1 1 pt. 9,055
  6. Avatar for RaeRae61 196. RaeRae61 Lv 1 1 pt. 9,054
  7. Avatar for larry25427 197. larry25427 Lv 1 1 pt. 9,053
  8. Avatar for valhal 198. valhal Lv 1 1 pt. 9,047
  9. Avatar for ivalnic 199. ivalnic Lv 1 1 pt. 9,046
  10. Avatar for briemoney 200. briemoney Lv 1 1 pt. 9,038

Comments