Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665
  1. Avatar for dahast.de 191. dahast.de Lv 1 1 pt. 9,076
  2. Avatar for Linapanama 192. Linapanama Lv 1 1 pt. 9,065
  3. Avatar for gab171 193. gab171 Lv 1 1 pt. 9,063
  4. Avatar for jermainiac 194. jermainiac Lv 1 1 pt. 9,056
  5. Avatar for Close At Hand 195. Close At Hand Lv 1 1 pt. 9,055
  6. Avatar for RaeRae61 196. RaeRae61 Lv 1 1 pt. 9,054
  7. Avatar for larry25427 197. larry25427 Lv 1 1 pt. 9,053
  8. Avatar for valhal 198. valhal Lv 1 1 pt. 9,047
  9. Avatar for ivalnic 199. ivalnic Lv 1 1 pt. 9,046
  10. Avatar for briemoney 200. briemoney Lv 1 1 pt. 9,038

Comments