Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for maribel1986 211. maribel1986 Lv 1 1 pt. 8,876
  2. Avatar for 01010011111 212. 01010011111 Lv 1 1 pt. 8,807
  3. Avatar for zkm 213. zkm Lv 1 1 pt. 8,741
  4. Avatar for marionte 214. marionte Lv 1 1 pt. 8,514
  5. Avatar for Zed3 215. Zed3 Lv 1 1 pt. 8,507
  6. Avatar for louismax13 216. louismax13 Lv 1 1 pt. 8,503
  7. Avatar for Helge1 217. Helge1 Lv 1 1 pt. 8,366
  8. Avatar for Clochette 218. Clochette Lv 1 1 pt. 8,354
  9. Avatar for Skippysk8s 219. Skippysk8s Lv 1 1 pt. 8,340
  10. Avatar for 0v1 220. 0v1 Lv 1 1 pt. 8,287

Comments