Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665

  1. Avatar for maribel1986 211. maribel1986 Lv 1 1 pt. 8,876
  2. Avatar for 01010011111 212. 01010011111 Lv 1 1 pt. 8,807
  3. Avatar for zkm 213. zkm Lv 1 1 pt. 8,741
  4. Avatar for marionte 214. marionte Lv 1 1 pt. 8,514
  5. Avatar for Zed3 215. Zed3 Lv 1 1 pt. 8,507
  6. Avatar for louismax13 216. louismax13 Lv 1 1 pt. 8,503
  7. Avatar for Helge1 217. Helge1 Lv 1 1 pt. 8,366
  8. Avatar for Clochette 218. Clochette Lv 1 1 pt. 8,354
  9. Avatar for Skippysk8s 219. Skippysk8s Lv 1 1 pt. 8,340
  10. Avatar for 0v1 220. 0v1 Lv 1 1 pt. 8,287

Comments