Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for t012 61. t012 Lv 1 21 pts. 9,650
  2. Avatar for fiendish_ghoul 62. fiendish_ghoul Lv 1 21 pts. 9,642
  3. Avatar for WarpSpeed 63. WarpSpeed Lv 1 20 pts. 9,641
  4. Avatar for Norrjane 64. Norrjane Lv 1 20 pts. 9,637
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 19 pts. 9,633
  6. Avatar for andrewxc 66. andrewxc Lv 1 18 pts. 9,631
  7. Avatar for Giant Berk 67. Giant Berk Lv 1 18 pts. 9,630
  8. Avatar for Glen B 68. Glen B Lv 1 17 pts. 9,624
  9. Avatar for gurch 69. gurch Lv 1 17 pts. 9,624
  10. Avatar for stomjoh 70. stomjoh Lv 1 16 pts. 9,622

Comments