Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665
  1. Avatar for Tlaloc 171. Tlaloc Lv 1 1 pt. 9,185
  2. Avatar for lacie 172. lacie Lv 1 1 pt. 9,185
  3. Avatar for Cerzax 173. Cerzax Lv 1 1 pt. 9,173
  4. Avatar for kosyumote 174. kosyumote Lv 1 1 pt. 9,170
  5. Avatar for kristinw18 175. kristinw18 Lv 1 1 pt. 9,163
  6. Avatar for darioarena 176. darioarena Lv 1 1 pt. 9,157
  7. Avatar for cnhrcolemam 177. cnhrcolemam Lv 1 1 pt. 9,154
  8. Avatar for momadoc 178. momadoc Lv 1 1 pt. 9,148
  9. Avatar for aspadistra 179. aspadistra Lv 1 1 pt. 9,136
  10. Avatar for petetrig 180. petetrig Lv 1 1 pt. 9,136

Comments