Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for lynnai 91. lynnai Lv 1 11 pts. 8,114
  2. Avatar for Merf 92. Merf Lv 1 11 pts. 8,099
  3. Avatar for georg137 93. georg137 Lv 1 11 pts. 8,090
  4. Avatar for uihcv 94. uihcv Lv 1 10 pts. 8,081
  5. Avatar for Incongruous 95. Incongruous Lv 1 10 pts. 8,064
  6. Avatar for ViJay7019 96. ViJay7019 Lv 1 10 pts. 8,050
  7. Avatar for dbuske 97. dbuske Lv 1 9 pts. 8,033
  8. Avatar for pfirth 98. pfirth Lv 1 9 pts. 8,029
  9. Avatar for fiendish_ghoul 99. fiendish_ghoul Lv 1 9 pts. 8,023
  10. Avatar for tallguy-13088 100. tallguy-13088 Lv 1 9 pts. 8,013

Comments