Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519
  1. Avatar for lynnai 91. lynnai Lv 1 11 pts. 8,114
  2. Avatar for Merf 92. Merf Lv 1 11 pts. 8,099
  3. Avatar for georg137 93. georg137 Lv 1 11 pts. 8,090
  4. Avatar for uihcv 94. uihcv Lv 1 10 pts. 8,081
  5. Avatar for Incongruous 95. Incongruous Lv 1 10 pts. 8,064
  6. Avatar for ViJay7019 96. ViJay7019 Lv 1 10 pts. 8,050
  7. Avatar for dbuske 97. dbuske Lv 1 9 pts. 8,033
  8. Avatar for pfirth 98. pfirth Lv 1 9 pts. 8,029
  9. Avatar for fiendish_ghoul 99. fiendish_ghoul Lv 1 9 pts. 8,023
  10. Avatar for tallguy-13088 100. tallguy-13088 Lv 1 9 pts. 8,013

Comments