Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for Mr_Jolty 121. Mr_Jolty Lv 1 4 pts. 7,779
  2. Avatar for Ernst Zundel 122. Ernst Zundel Lv 1 4 pts. 7,778
  3. Avatar for Pro Lapser 123. Pro Lapser Lv 1 4 pts. 7,777
  4. Avatar for Mydogisa Toelicker 124. Mydogisa Toelicker Lv 1 4 pts. 7,776
  5. Avatar for Colostomy EXPLOSION. 125. Colostomy EXPLOSION. Lv 1 4 pts. 7,776
  6. Avatar for NameChangeNeeded01 126. NameChangeNeeded01 Lv 1 4 pts. 7,776
  7. Avatar for PrettyPony2001 127. PrettyPony2001 Lv 1 4 pts. 7,775
  8. Avatar for TJOK fan 128. TJOK fan Lv 1 3 pts. 7,772
  9. Avatar for nathanmills 129. nathanmills Lv 1 3 pts. 7,766
  10. Avatar for Soggy Doglog 130. Soggy Doglog Lv 1 3 pts. 7,766

Comments