Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for Jim Fraser 131. Jim Fraser Lv 1 3 pts. 7,765
  2. Avatar for Mohambone 132. Mohambone Lv 1 3 pts. 7,758
  3. Avatar for SineniF 133. SineniF Lv 1 3 pts. 7,743
  4. Avatar for SouperGenious 134. SouperGenious Lv 1 3 pts. 7,736
  5. Avatar for demeter900 135. demeter900 Lv 1 3 pts. 7,688
  6. Avatar for MurloW 136. MurloW Lv 1 3 pts. 7,678
  7. Avatar for cakesok 137. cakesok Lv 1 3 pts. 7,647
  8. Avatar for cherry39 138. cherry39 Lv 1 2 pts. 7,625
  9. Avatar for Close At Hand 139. Close At Hand Lv 1 2 pts. 7,620
  10. Avatar for pllq 140. pllq Lv 1 2 pts. 7,616

Comments